PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00015.1_g00048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 1074aa    MW: 119057 Da    PI: 6.6992
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00015.1_g00048.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.2e-23126227199
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+
  Rsa1.0_00015.1_g00048.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDS 209
                              99*****************************954.4444.48******************************************** PP

                              EEEEE-SSSEE..EEEEE-S CS
                       B3  80 vvFkldgrsefelvvkvfrk 99 
                              v+F   ++++ +l+++++r+
  Rsa1.0_00015.1_g00048.1 210 VLFV--RDEKSQLTLGIRRA 227
                              ****..45677789999997 PP

2Auxin_resp118.55.3e-39252334183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  Rsa1.0_00015.1_g00048.1 252 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 334
                              799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.05E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-41120241IPR015300DNA-binding pseudobarrel domain
CDDcd100179.70E-21125226No hitNo description
PfamPF023622.1E-21126227IPR003340B3 DNA binding domain
SMARTSM010194.3E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.492126228IPR003340B3 DNA binding domain
PfamPF065077.4E-34252334IPR010525Auxin response factor
PfamPF023094.9E-109441032IPR033389AUX/IAA domain
PROSITE profilePS5174525.6659461039IPR000270PB1 domain
SuperFamilySSF542771.81E-89601024No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1074 aa     Download sequence    Send to blast
MKAPSNGFHP NPAEGEKKAI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKINR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFVRDEKSQL TLGIRRANRQ TPTLSSSVIS  240
SDSMHIGILA AAAHANANSS PFTIFFNPRA SPSEFVVPLA KYNKALYAQV SLGMRFRMMF  300
ETEDCGVRRY MGTVTGISDL DPVRWKGSQW RNLQVGWDES TAGDRPSRVS IWEIEPVITP  360
FYICPPPFFR PKYPRQPGMP DDELDMENAF KRAMPWMGEE FGMKDAQSSM FPGLSLVQWM  420
SMQQNNPLSA GAATAQLPSY NLPNNFAPND HSKLLNFQSP NLSPANTQFN KPNMVSHISQ  480
QMQAQPAMVQ SQQQQQQLQQ QVQMSHQQLQ QHHHHQQQQG GYNTGSVNNG VSGVSNQVSC  540
QNQSTGFTQS QLQQQSMLSN GAKMTHQNMV SAGNKASSQM TAQELQFQQQ LELHNSTQLL  600
RNQQEQSSMH PLQQTLSQNP QQLQMQQQQQ QSSKPSPSQQ LQLQLLQKLQ QQQQSTPPLV  660
SSSLQPQLPS LQQTQSHQLQ QLLSSQNQQP LPQSNNSFMQ PPQIQVSHHQ QQGYMNNNNK  720
PVAAGRSQSG HIDGEAPSCS TSPSANNTGG HDNVSPTNFL SRNQQQGQAV SVSVPVPVPA  780
SDSVFERASN PVQQGMVNLK SATEQFKFKG AVTDQIDVTI VGTTYCPDVV GPGQQQQQQQ  840
QTFPLPSFGF DGDLQTHHPR NNLAYAGNLE AVNPDALYSQ KDFQNLVPNY GNAPRDIETE  900
LSSASQSFGI PSIPFKSGGS NEIGGINDSG IMNGGGIWPN QAQRMRTYTK VQKRGSVGRS  960
IDVTRYSGYE ELRHDLARMF GIEGQLEDPQ TSDWKLVYTD HENDILLVGD DPWEEFVNCV  1020
QNIKILSSAE VQQMSLDGDL AAIPTTNQAC SETDSGNAWK VHYEDTSAAA SFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1711635547388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794840.0JN979484.1 Brassica rapa subsp. pekinensis auxin response factor 19-2 (ARF19-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586633.10.0PREDICTED: auxin response factor 19 isoform X1
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLA0A0D3CBG40.0A0A0D3CBG4_BRAOL; Auxin response factor
STRINGBra025720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19